| Edit |   |
| Antigenic Specificity | Phosphopantothenate-cysteine ligase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Phosphopantothenate-cysteine ligase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Phosphopantothenate-cysteine ligase. This antibody reacts with human. The Phosphopantothenate-cysteine ligase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Phosphopantothenate-cysteine ligase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ISFKLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQSR |
| Other Names | FLJ11838, MGC117357, phosphopantothenoylcysteine synthetase, PPC synthetase |
| Gene, Accession # | PPCS, Gene ID: 79717, Accession: Q9HAB8, SwissProt: Q9HAB8 |
| Catalog # | NBP2-38181 |
| Price | |
| Order / More Info | Phosphopantothenate-cysteine ligase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |