| Edit |   |
|---|
| Antigenic Specificity | Phosphoribosyl Pyrophosphate Amidotransferase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Phosphoribosyl Pyrophosphate Amidotransferase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Phosphoribosyl Pyrophosphate Amidotransferase. This antibody reacts with human. The Phosphoribosyl Pyrophosphate Amidotransferase Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Phosphoribosyl Pyrophosphate Amidotransferase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPI |
|---|
| Other Names | ATASE, EC 2.4.2.14, glutamine phosphoribosylpyrophosphatate amidotransferase, Glutamine phosphoribosylpyrophosphate amidotransferase, glutamine PRPP amidotransferase, GPATamidophosphoribosyltransferase, phosphoribosyl pyrophosphate amidotransferase, PRAT |
|---|
| Gene, Accession # | PPAT, Gene ID: 5471, Accession: Q06203, SwissProt: Q06203 |
|---|
| Catalog # | NBP2-38279 |
|---|
| Price | |
|---|
| Order / More Info | Phosphoribosyl Pyrophosphate Amidotransferase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|