| Edit |   |
|---|
| Antigenic Specificity | COX20 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat, mouse, horse, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-COX20 Antibody |
|---|
| Immunogen | The immunogen for anti-COX20 antibody: synthetic peptide directed towards the C terminal of human COX20. Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN |
|---|
| Other Names | FAM36A, COX20 cytochrome C oxidase assembly factor |
|---|
| Gene, Accession # | FA36A, Accession: NM_198076 |
|---|
| Catalog # | TA337607 |
|---|
| Price | |
|---|
| Order / More Info | COX20 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|