| Edit |   |
|---|
| Antigenic Specificity | TRAPPC6A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRAPPC6A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAPPC6A. This antibody reacts with human. The TRAPPC6A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TRAPPC6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLR |
|---|
| Other Names | HSPC289, MGC2650, trafficking protein particle complex 6A, trafficking protein particle complex subunit 6A, TRAPP complex subunit 6A, TRAPPC6Adelta29-42, TRS33 |
|---|
| Gene, Accession # | TRAPPC6A, Gene ID: 79090, Accession: O75865, SwissProt: O75865 |
|---|
| Catalog # | NBP1-83167 |
|---|
| Price | |
|---|
| Order / More Info | TRAPPC6A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29366750 |
|---|