| Edit |   |
|---|
| Antigenic Specificity | TRAPPC6B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRAPPC6B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAPPC6B. This antibody reacts with human. The TRAPPC6B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TRAPPC6B(trafficking protein particle complex 6B) The peptide sequence was selected from the middle region of TRAPPC6B. Peptide sequence TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF. |
|---|
| Other Names | FLJ17772, FLJ79549, TPC6, trafficking protein particle complex 6B |
|---|
| Gene, Accession # | TRAPPC6B, Gene ID: 122553 |
|---|
| Catalog # | NBP1-70736-20ul |
|---|
| Price | |
|---|
| Order / More Info | TRAPPC6B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|