| Edit |   |
|---|
| Antigenic Specificity | TRAPPC2L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRAPPC2L Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAPPC2L. This antibody reacts with human. The TRAPPC2L Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TRAPPC2L(trafficking protein particle complex 2-like) The peptide sequence was selected from the N terminal of TRAPPC2L. Peptide sequence MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL. |
|---|
| Other Names | MGC111156, trafficking protein particle complex 2-like, trafficking protein particle complex subunit 2-like protein |
|---|
| Gene, Accession # | TRAPPC2L, Gene ID: 51693 |
|---|
| Catalog # | NBP1-70735-20ul |
|---|
| Price | |
|---|
| Order / More Info | TRAPPC2L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|