| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Trappin-2/Elafin/Skalp |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB and IHC reactivity reported in (PMID: 27444067). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Trappin-2/Elafin/Skalp Antibody from Novus Biologicals is a rabbit polyclonal antibody to Trappin-2/Elafin/Skalp. This antibody reacts with human. The Trappin-2/Elafin/Skalp Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Trappin-2/Elafin/Skalp antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA |
|---|
| Other Names | cementoin, Elastase-specific inhibitor, ESIWAP four-disulfide core domain protein 14, Peptidase inhibitor 3, peptidase inhibitor 3, skin-derived, PI-3, pre-elafin, protease inhibitor 3, skin-derived (SKALP), Protease inhibitor WAP3, SKALPELAFIN, Skin-derived antileukoproteinase, trappin-2, WAP four-disulfide core domain 14, WAP3MGC13613, WFDC14elafin |
|---|
| Gene, Accession # | PI3, Gene ID: 5266 |
|---|
| Catalog # | NBP1-85690 |
|---|
| Price | |
|---|
| Order / More Info | Trappin-2/Elafin/Skalp Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23631827, 27442805, 27444067 |
|---|
| 产品资料 |
|
|