| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Crossveinless-2/CV-2/BMPER |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Crossveinless-2/CV-2/BMPER Antibody from Novus Biologicals is a rabbit polyclonal antibody to Crossveinless-2/CV-2/BMPER. This antibody reacts with human. The Crossveinless-2/CV-2/BMPER Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to BMPER(BMP binding endothelial regulator) The peptide sequence was selected from the C terminal of BMPER. Peptide sequence NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV. |
|---|
| Other Names | BMP binding endothelial regulator, BMP-binding endothelial regulator precursor protein, BMP-binding endothelial regulator protein, Bone morphogenetic protein-binding endothelial cell precursor-derived regulator, CRIM3, crossveinless 2, crossveinless-2, Cv2, CV-2, hCV2, KIAA1965, Protein crossveinless-2 |
|---|
| Gene, Accession # | BMPER, Gene ID: 168667, Accession: Q8N8U9, SwissProt: Q8N8U9 |
|---|
| Catalog # | NBP1-58041 |
|---|
| Price | |
|---|
| Order / More Info | Crossveinless-2/CV-2/BMPER Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|