| 产品详情 |
| Edit |   |
| Antigenic Specificity | ZDHHC17 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZDHHC17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZDHHC17. This antibody reacts with human. The ZDHHC17 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZDHHC17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVR |
| Other Names | DHHC-17, EC 2.3.1, EC 2.3.1.-, HIP14HIP-14, huntingtin interacting protein 14, huntingtin interacting protein 3, Huntingtin interacting protein H, Huntingtin yeast partner H, Huntingtin-interacting protein 14, Huntingtin-interacting protein 3, Huntingtin-interacting protein H, HYPHHIP-3, KIAA0946HIP3, palmitoyltransferase ZDHHC17, Putative MAPK-activating protein PM11, Putative NF-kappa-B-activating protein 205, Zinc finger DHHC domain-containing protein 17, zinc finger, DHHC domain containing 17, zinc finger, DHHC-type containing 17 |
| Gene, Accession # | ZDHHC17, Gene ID: 23390 |
| Catalog # | NBP1-81748 |
| Price | |
| Order / More Info | ZDHHC17 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|