| 产品详情 |
| Edit |   |
| Antigenic Specificity | ZDHHC7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZDHHC7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZDHHC7. This antibody reacts with human. The ZDHHC7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZDHHC7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SACTVKTGLDPTLVGICGEGTESVQSLLLGAVPKGNATKEYMESLQLKPGEVIYKCPKCC |
| Other Names | EC 2.3.1, EC 2.3.1.-, FLJ10792, FLJ20279, palmitoyltransferase ZDHHC7, Sertoli cell gene with zinc finger domain- and #946, SERZ1, SERZ-B, Zinc finger DHHC domain-containing protein 7, Zinc finger protein 370, zinc finger, DHHC domain containing 7, zinc finger, DHHC-type containing 7, ZNF370DHHC-7 |
| Gene, Accession # | ZDHHC7, Gene ID: 55625, Accession: Q9NXF8, SwissProt: Q9NXF8 |
| Catalog # | NBP2-33884 |
| Price | |
| Order / More Info | ZDHHC7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|