| Edit |   |
| Antigenic Specificity | ZDHHC11/ZDHHC11B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZDHHC11/ZDHHC11B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZDHHC11/ZDHHC11B. This antibody reacts with rat. The ZDHHC11/ZDHHC11B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Zdhhc11 (NP_001034431). Peptide sequence TIDPADTNVRLKKDYLEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHC. |
| Other Names | DHHC-11B, ZDHHC11B, zinc finger, DHHC-type containing 11B |
| Gene, Accession # | ZDHHC11B, Gene ID: 653082, Accession: P0C7U3, SwissProt: P0C7U3 |
| Catalog # | NBP1-79327-20ul |
| Price | |
| Order / More Info | ZDHHC11/ZDHHC11B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |