| Edit |   |
| Antigenic Specificity | ENOPH1 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | dog, guinea pig, human, porcine |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ENOPH1 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-ENOPH1 antibody: synthetic peptide directed towards the N terminal of human ENOPH1. Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD |
| Other Names | E1, MASA, MST145, mtnC, enolase-phosphatase 1 |
| Gene, Accession # | ENOPH, Accession: NM_021204 |
| Catalog # | TA344730 |
| Price | |
| Order / More Info | ENOPH1 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |