| Edit |   |
| Antigenic Specificity | ZNF385 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF385 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF385. This antibody reacts with human. The ZNF385 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptide directed towards the C terminal of human ZNF385. Peptide sequence LKQHISSRRHRDGVAGKPNPLLSRHKKSRGAGELAGTLTFSKELPKSLAG. |
| Other Names | bA179N14.1, zinc finger protein 334 |
| Gene, Accession # | ZNF385A, Gene ID: 25946, Accession: NP_056296, SwissProt: NP_056296 |
| Catalog # | NBP1-79983-20ul |
| Price | |
| Order / More Info | ZNF385 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |