| Edit |   |
|---|
| Antigenic Specificity | ZNF385 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF385 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF385. This antibody reacts with human. The ZNF385 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF385. Peptide sequence EPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNS. |
|---|
| Other Names | bA179N14.1, zinc finger protein 334 |
|---|
| Gene, Accession # | ZNF385A, Gene ID: 25946, Accession: NP_056296, SwissProt: NP_056296 |
|---|
| Catalog # | NBP1-80004-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZNF385 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|