| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | POLR2J |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The POLR2J Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLR2J. This antibody reacts with human. The POLR2J Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human POLR2J antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR |
|---|
| Other Names | DNA-directed RNA polymerase II subunit J-1, DNA-directed RNA polymerase II subunit RPB11-a, hRPB14, MGC71910, POLR2J1RNA polymerase II subunit B11-a, polymerase (RNA) II (DNA directed) polypeptide J (13.3kD), polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa, RNA polymerase II 13.3 kDa subunit, RPB11, RPB11A, RPB11m |
|---|
| Gene, Accession # | POLR2J, Gene ID: 5439, Accession: P52435 |
|---|
| Catalog # | NBP2-46697 |
|---|
| Price | |
|---|
| Order / More Info | POLR2J Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|