| Edit |   |
| Antigenic Specificity | BRPF3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BRPF3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRPF3. This antibody reacts with human. The BRPF3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human BRPF3The immunogen for this antibody is BRPF3. Peptide sequence CNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFRMVD. |
| Other Names | bromodomain and PHD finger containing, 3, bromodomain and PHD finger-containing protein 3, KIAA1286 |
| Gene, Accession # | BRPF3, Gene ID: 27154, Accession: NP_056510, SwissProt: NP_056510 |
| Catalog # | NBP1-79382 |
| Price | |
| Order / More Info | BRPF3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |