| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BRP44L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BRP44L Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRP44L. This antibody reacts with human, mouse. The BRP44L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse BRP44L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR |
|---|
| Other Names | brain protein 44-like, brain protein 44-like protein, CGI-129, dJ68L15.3, HSPC040 protein |
|---|
| Gene, Accession # | MPC1, Gene ID: 51660 |
|---|
| Catalog # | NBP1-91706 |
|---|
| Price | |
|---|
| Order / More Info | BRP44L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26198749, 27852261, 28624784, 30712844 |
|---|
| 产品资料 |
|
|