| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DYNC1I2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DYNC1I2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DYNC1I2. This antibody reacts with human. The DYNC1I2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human DYNC1I2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE |
|---|
| Other Names | cytoplasmic dynein 1 intermediate chain 2, Cytoplasmic dynein intermediate chain 2, DH IC-2, DNCI2MGC104199, DNCIC2, Dynein intermediate chain 2, cytosolic, dynein, cytoplasmic 1, intermediate chain 2, dynein, cytoplasmic, intermediate polypeptide 2, FLJ21089, FLJ90842, IC2, MGC111094, MGC9324 |
|---|
| Gene, Accession # | DYNC1I2, Gene ID: 1781, Accession: Q13409, SwissProt: Q13409 |
|---|
| Catalog # | NBP2-38469 |
|---|
| Price | |
|---|
| Order / More Info | DYNC1I2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|