| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | dynein, cytoplasmic 2, light intermediate chain 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The dynein, cytoplasmic 2, light intermediate chain 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to dynein, cytoplasmic 2, light intermediate chain 1. This antibody reacts with human. The dynein, cytoplasmic 2, light intermediate chain 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human dynein, cytoplasmic 2, light intermediate chain 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL |
|---|
| Other Names | CGI-60, cytoplasmic dynein 2 light intermediate chain 1, D2LICDKFZp564A033, DKFZP564A033, dynein, cytoplasmic 2, light intermediate chain 1, LIC3Dynein 2 light intermediate chain |
|---|
| Gene, Accession # | DYNC2LI1, Gene ID: 51626, Accession: Q8TCX1, SwissProt: Q8TCX1 |
|---|
| Catalog # | NBP2-38008 |
|---|
| Price | |
|---|
| Order / More Info | dynein, cytoplasmic 2, light intermediate chain 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|