| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Dynein heavy chain |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dynein heavy chain Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dynein heavy chain. This antibody reacts with human. The Dynein heavy chain Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Dynein heavy chain antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL |
|---|
| Other Names | axonemal, heavy polypeptide 9, ciliary dynein heavy chain 9, DNAH9 variant protein, DYH9, dynein heavy chain 9, axonemal, dynein, axonemal, heavy chain 9, HL20 |
|---|
| Gene, Accession # | DNAH9, Gene ID: 1770, Accession: Q9NYC9, SwissProt: Q9NYC9 |
|---|
| Catalog # | NBP2-38671 |
|---|
| Price | |
|---|
| Order / More Info | Dynein heavy chain Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|