| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DYNLT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DYNLT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DYNLT1. This antibody reacts with human. The DYNLT1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human DYNLT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASS |
|---|
| Other Names | CW-1, dynein light chain Tctex-type 1, dynein, light chain, Tctex-type 1, MGC111571, Protein CW-1, T-complex testis-specific protein 1 homolog, t-complex-associated-testis-expressed 1-like 1, TCTEL1tctex-1, TCTEX1, TCTEX-1 |
|---|
| Gene, Accession # | DYNLT1, Gene ID: 6993 |
|---|
| Catalog # | NBP2-58497 |
|---|
| Price | |
|---|
| Order / More Info | DYNLT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|