| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DYNLT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DYNLT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DYNLT3. This antibody reacts with human, rat. The DYNLT3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, rat DYNLT3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE |
|---|
| Other Names | dynein, light chain, Tctex-type 3, Protein 91/23, RP3, T-complex-associated testis-expressed 1-like, t-complex-associated-testis-expressed 1-like, TCTE1Ldynein light chain Tctex-type 3, TCTE1XL, TCTEX1L |
|---|
| Gene, Accession # | DYNLT3, Gene ID: 6990, Accession: P51808, SwissProt: P51808 |
|---|
| Catalog # | NBP1-80698 |
|---|
| Price | |
|---|
| Order / More Info | DYNLT3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|