| Edit |   |
| Antigenic Specificity | Neurochondrin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Neurochondrin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neurochondrin. This antibody reacts with human. The Neurochondrin Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to NCDN(neurochondrin) The peptide sequence was selected from the N terminal of NCDN. Peptide sequence MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS. |
| Other Names | KIAA0607NCDN-1, NCDN-2, neurochondrin |
| Gene, Accession # | NCDN, Gene ID: 23154, Accession: Q9UBB6, SwissProt: Q9UBB6 |
| Catalog # | NBP1-55390-20ul |
| Price | |
| Order / More Info | Neurochondrin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |