| Edit |   |
|---|
| Antigenic Specificity | Neurochondrin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Neurochondrin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neurochondrin. This antibody reacts with human. The Neurochondrin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NCDN(neurochondrin) The peptide sequence was selected from the N terminal of NCDN. Peptide sequence MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS. |
|---|
| Other Names | KIAA0607NCDN-1, NCDN-2, neurochondrin |
|---|
| Gene, Accession # | NCDN, Gene ID: 23154, Accession: Q9UBB6, SwissProt: Q9UBB6 |
|---|
| Catalog # | NBP1-55390-20ul |
|---|
| Price | |
|---|
| Order / More Info | Neurochondrin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|