| 产品详情 |
| Edit |   |
| Antigenic Specificity | Neuro D4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Neuro D4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neuro D4. This antibody reacts with human. The Neuro D4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Neuro D4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRR KNRAKGKAYGIGGLRKRQDTASLEDR |
| Other Names | BAF45B, BRG1-associated factor 45B, D4, zinc and double PHD fingers family 1NEUD4BAF45b, MGC150428, MGC150429, neuro-d4, neuro-d4 homolog, zinc finger protein neuro-d4 |
| Gene, Accession # | DPF1, Gene ID: 8193 |
| Catalog # | NBP2-13932 |
| Price | |
| Order / More Info | Neuro D4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|