| Edit |   |
| Antigenic Specificity | RIC8A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RIC8A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RIC8A. This antibody reacts with human. The RIC8A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RIC8A (resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)) The peptide sequence was selected from the N terminal of RIC8A. Peptide sequence KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKG |
| Other Names | RIC8, RIC8A resistance to inhibitors of cholinesterase 8 homolog A (C. elegans), synembryn, synembryn-A |
| Gene, Accession # | RIC8A, Gene ID: 60626, Accession: Q9NPQ8-3, SwissProt: Q9NPQ8-3 |
| Catalog # | NBP1-57011-20ul |
| Price | |
| Order / More Info | RIC8A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |