| Edit |   |
|---|
| Antigenic Specificity | RIC8A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RIC8A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RIC8A. This antibody reacts with human. The RIC8A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RIC8A (resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)) The peptide sequence was selected from the N terminal of RIC8A. Peptide sequence KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKG |
|---|
| Other Names | RIC8, RIC8A resistance to inhibitors of cholinesterase 8 homolog A (C. elegans), synembryn, synembryn-A |
|---|
| Gene, Accession # | RIC8A, Gene ID: 60626, Accession: Q9NPQ8-3, SwissProt: Q9NPQ8-3 |
|---|
| Catalog # | NBP1-57011 |
|---|
| Price | |
|---|
| Order / More Info | RIC8A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|