| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RICS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RICS Antibody from Novus Biologicals is a rabbit polyclonal antibody to RICS. This antibody reacts with human. The RICS Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RICS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE |
|---|
| Other Names | brain-specific Rho GTP-ase-activating protein, Brain-specific Rho GTPase-activating protein, GAB-associated CDC42, GAB-associated Cdc42/Rac GTPase-activating protein, GC-GAPGTPase regulator interacting with TrkA, GRITp200RhoGAP, KIAA0712p250GAP, MGC1892, rac GTPase activating protein, Rho GTPase activating protein 32, rho GTPase-activating protein 32, Rho/Cdc42/Rac GTPase-activating protein RICS, RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling, RhoGAP involved in the -catenin-N-cadherin and NMDA receptor signaling, Rho-type GTPase-activating protein 32, RICSPX-RICS |
|---|
| Gene, Accession # | ARHGAP32, Gene ID: 9743 |
|---|
| Catalog # | NBP1-92334 |
|---|
| Price | |
|---|
| Order / More Info | RICS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|