| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Rictor |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Rictor Antibody from Novus Biologicals is a rabbit polyclonal antibody to Rictor. This antibody reacts with human. The Rictor Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Rictor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDK |
|---|
| Other Names | AVO3, AVO3 homolog, hAVO3, KIAA1999DKFZp686B11164, mAVO3, MGC39830, PIA, pianissimo, rapamycin-insensitive companion of mTOR, RPTOR independent companion of MTOR, complex 2, TORC2-specific protein AVO3 |
|---|
| Gene, Accession # | RICTOR, Gene ID: 253260, Accession: Q6R327, SwissProt: Q6R327 |
|---|
| Catalog # | NBP2-38365 |
|---|
| Price | |
|---|
| Order / More Info | Rictor Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|