Edit |   |
Antigenic Specificity | DYRK4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 44%, rat 44%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human DYRK4 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNV |
Other Names | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 |
Gene, Accession # | Gene ID: 8798, UniProt: Q9NR20, ENSG00000010219 |
Catalog # | HPA056073 |
Price | |
Order / More Info | DYRK4 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |