| 产品详情 |
| Edit |   |
| Antigenic Specificity | TEX101 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TEX101 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TEX101. This antibody reacts with human. The TEX101 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TEX101 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPG |
| Other Names | cancer/testis antigen 131, Cell surface receptor NYD-SP8, CT131, MGC4766, NYD-SP8, PRO1884, Scleroderma-associated autoantigen, SGRGGTPR867, Spermatogenesis-related gene protein, TES101RP, testis expressed 101, testis expressed sequence 101, testis-expressed protein 101, testis-specific protein TES101RP |
| Gene, Accession # | TEX101, Gene ID: 83639 |
| Catalog # | NBP1-84357 |
| Price | |
| Order / More Info | TEX101 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23276153, 24598113 |
| 产品资料 |
|
|