| Edit |   |
| Antigenic Specificity | TEX19 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TEX19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TEX19. This antibody reacts with human. The TEX19 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FLJ35767(FLJ35767 protein) The peptide sequence was selected from the middle region of FLJ35767. Peptide sequence PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS. |
| Other Names | FLJ35767, testis expressed 19, testis-expressed sequence 19 protein |
| Gene, Accession # | TEX19, Gene ID: 400629, Accession: Q8NA77, SwissProt: Q8NA77 |
| Catalog # | NBP1-56811 |
| Price | |
| Order / More Info | TEX19 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |