| Edit |   |
| Antigenic Specificity | TEX47 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TEX47 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TEX47. This antibody reacts with human. The TEX47 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MGC26647(hypothetical protein MGC26647) The peptide sequence was selected from the N terminal of MGC26647. Peptide sequence EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA. |
| Other Names | chromosome 7 open reading frame 62, hypothetical protein LOC219557 |
| Gene, Accession # | C7orf62, Gene ID: 219557 |
| Catalog # | NBP1-70480 |
| Price | |
| Order / More Info | TEX47 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |