| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TFAP2D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TFAP2D Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFAP2D. This antibody reacts with human. The TFAP2D Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat TFAP2D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRK TSEAAVKEGK |
|---|
| Other Names | Activating enhancer-binding protein 2-delta, AP-2 like, AP2-delta, TFAP2BL1activating enhancer binding protein 2 beta-like 1, transcription factor AP-2 beta (activating enhancer binding protein 2beta)-like 1, transcription factor AP-2 beta (activating enhancer-binding protein 2beta)-like 1, transcription factor AP-2 delta (activating enhancer binding protein 2 delta), Transcription factor AP-2-beta-like 1, transcription factor AP-2-delta |
|---|
| Gene, Accession # | TFAP2D, Gene ID: 83741 |
|---|
| Catalog # | NBP2-13428 |
|---|
| Price | |
|---|
| Order / More Info | TFAP2D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|