| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | A-RAF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The A-RAF Antibody from Novus Biologicals is a rabbit polyclonal antibody to A-RAF. This antibody reacts with human. The A-RAF Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human A-RAF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDS |
|---|
| Other Names | ARAF1A-RAF, EC 2.7.11, EC 2.7.11.1, Oncogene ARAF1, PKS, PKS2A-Raf proto-oncogene serine/threonine-protein kinase, Proto-oncogene A-Raf, Proto-oncogene A-Raf-1, Proto-oncogene Pks, RAFA1, Ras-binding protein DA-Raf, serine/threonine-protein kinase A-Raf, v-raf murine sarcoma 3611 viral oncogene homolog, v-raf murine sarcoma 3611 viral oncogene homolog 1 |
|---|
| Gene, Accession # | ARAF, Gene ID: 369 |
|---|
| Catalog # | NBP2-55054 |
|---|
| Price | |
|---|
| Order / More Info | A-RAF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|