| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALDH1L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALDH1L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALDH1L2. This antibody reacts with human. The ALDH1L2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKT |
|---|
| Other Names | aldehyde dehydrogenase 1 family, member L2, aldehyde dehydrogenase family 1 member L2, DKFZp686A16126, DKFZp686M064, EC 1.5.1.6, FLJ36769, FLJ38508, MGC119536, MGC119537,10-formyltetrahydrofolate dehydrogenase ALDH1L2, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, mtFDHDKFZp686P14145, probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2 |
|---|
| Gene, Accession # | ALDH1L2, Gene ID: 160428 |
|---|
| Catalog # | NBP2-68750 |
|---|
| Price | |
|---|
| Order / More Info | ALDH1L2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|