| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALDH1L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALDH1L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALDH1L2. This antibody reacts with human. The ALDH1L2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ALDH1L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP |
|---|
| Other Names | aldehyde dehydrogenase 1 family, member L2, aldehyde dehydrogenase family 1 member L2, DKFZp686A16126, DKFZp686M064, EC 1.5.1.6, FLJ36769, FLJ38508, MGC119536, MGC119537,10-formyltetrahydrofolate dehydrogenase ALDH1L2, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, mtFDHDKFZp686P14145, probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2 |
|---|
| Gene, Accession # | ALDH1L2, Gene ID: 160428, Accession: Q3SY69, SwissProt: Q3SY69 |
|---|
| Catalog # | NBP1-81935 |
|---|
| Price | |
|---|
| Order / More Info | ALDH1L2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|