| 产品详情 |
| Edit |   |
| Antigenic Specificity | Aldo-keto Reductase 1B10/AKR1B10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Aldo-keto Reductase 1B10/AKR1B10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aldo-keto Reductase 1B10/AKR1B10. This antibody reacts with human. The Aldo-keto Reductase 1B10/AKR1B10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Aldo-keto Reductase 1B10/AKR1B10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT |
| Other Names | AKR1B11, AKR1B12, aldo-keto reductase family 1 member B10, aldo-keto reductase family 1, member B10 (aldose reductase), aldo-keto reductase family 1, member B11 (aldose reductase-like), Aldose reductase-like, aldose reductase-like 1, aldose reductase-like peptide, Aldose reductase-related protein, ALDRLn, ARL1, ARL-1SI reductase, ARP, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.21, hARP, HIS, HSI, MGC14103, Small intestine reductase |
| Gene, Accession # | AKR1B10, Gene ID: 57016 |
| Catalog # | NBP1-89161 |
| Price | |
| Order / More Info | Aldo-keto Reductase 1B10/AKR1B10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|