| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kallikrein 15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kallikrein 15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kallikrein 15. This antibody reacts with human. The Kallikrein 15 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kallikrein 15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTS |
|---|
| Other Names | ACO, ACO protease, EC 3.4.21, EC 3.4.21.-, EC 3.4.21.4, HSRNASPH, kallikrein 15, kallikrein-15, kallikrein-like serine protease, kallikrein-related peptidase 15, prostinogen |
|---|
| Gene, Accession # | KLK15, Gene ID: 55554 |
|---|
| Catalog # | NBP1-90265 |
|---|
| Price | |
|---|
| Order / More Info | Kallikrein 15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|