| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kallikrein 7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kallikrein 7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kallikrein 7. This antibody reacts with human. The Kallikrein 7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kallikrein 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSM |
|---|
| Other Names | EC 3.4.21, EC 3.4.21.117, hK7, hSCCE, kallikrein 7 (chymotryptic, stratum corneum), kallikrein-related peptidase 7, protease, serine, 6, PRSS6, SCCEkallikrein-7, Serine protease 6, signal protein, Stratum corneum chymotryptic enzyme |
|---|
| Gene, Accession # | KLK7, Gene ID: 5650, Accession: P49862, SwissProt: P49862 |
|---|
| Catalog # | NBP2-38950 |
|---|
| Price | |
|---|
| Order / More Info | Kallikrein 7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|