| Edit |   |
| Antigenic Specificity | SLC26A9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SLC26A9 Antibody |
| Immunogen | The immunogen for Anti-SLC26A9 Antibody: synthetic peptide directed towards the middle region of human SLC26A9. Synthetic peptide located within the following region: LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD |
| Other Names | solute carrier family 26 (anion exchanger),member 9 |
| Gene, Accession # | S26A9, Accession: NM_052934 |
| Catalog # | TA333569 |
| Price | |
| Order / More Info | SLC26A9 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |