| Edit |   |
|---|
| Antigenic Specificity | LC3C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LC3C Antibody from Novus Biologicals is a rabbit polyclonal antibody to LC3C. This antibody reacts with human. The LC3C Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human LC3C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TKFLVPQELTMTQFLSIIRSRMVLRATEAF |
|---|
| Other Names | ATG8J, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, LC3C, LC3-like protein 2, MAP1 light chain 3-like protein 2, MAP1 light chain 3-like protein 3, MAP1A/MAP1B LC3 C, microtubule-associated protein 1 light chain 3 gammaMAP1A/MAP1B light chain 3 C, microtubule-associated proteins 1A/1B light chain 3C |
|---|
| Gene, Accession # | MAP1LC3C, Gene ID: 440738 |
|---|
| Catalog # | NBP2-57604 |
|---|
| Price | |
|---|
| Order / More Info | LC3C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|