| Edit |   |
| Antigenic Specificity | MYLIP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-MYLIP Antibody |
| Immunogen | The immunogen for anti-MYLIP antibody: synthetic peptide directed towards the middle region of human MYLIP. Synthetic peptide located within the following region: CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE |
| Other Names | IDOL, MIR, myosin regulatory light chain interacting protein |
| Gene, Accession # | MYLIP, Accession: NM_013262 |
| Catalog # | TA329831 |
| Price | |
| Order / More Info | MYLIP Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |