| 产品详情 |
| Edit |   |
| Antigenic Specificity | DCUN1D1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 24874471). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DCUN1D1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCUN1D1. This antibody reacts with human. The DCUN1D1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DCUN1D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR |
| Other Names | DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae), DCN1-like protein 1, DCUN1L1DCUN1 domain-containing protein 1, Defective in cullin neddylation protein 1-like protein 1, RP42 homolog, RP42Squamous cell carcinoma-related oncogene, SCCROSCRO, Tes3 |
| Gene, Accession # | DCUN1D1, Gene ID: 54165 |
| Catalog # | NBP1-85275 |
| Price | |
| Order / More Info | DCUN1D1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24874471 |
| 产品资料 |
|
|