| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DCUN1D1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DCUN1D1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCUN1D1. This antibody reacts with human. The DCUN1D1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to DCUN1D1(DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)) The peptide sequence was selected from the N terminal of DCUN1D1. Peptide sequence SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKK |
|---|
| Other Names | DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae), DCN1-like protein 1, DCUN1L1DCUN1 domain-containing protein 1, Defective in cullin neddylation protein 1-like protein 1, RP42 homolog, RP42Squamous cell carcinoma-related oncogene, SCCROSCRO, Tes3 |
|---|
| Gene, Accession # | DCUN1D1, Gene ID: 54165, Accession: Q96GG9, SwissProt: Q96GG9 |
|---|
| Catalog # | NBP1-56537 |
|---|
| Price | |
|---|
| Order / More Info | DCUN1D1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|