| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DCUN1D4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DCUN1D4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCUN1D4. This antibody reacts with human. The DCUN1D4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DCUN1D4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCF |
|---|
| Other Names | DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae), DCN1-like protein 4, DCUN1 domain-containing protein 4, FLJ42355, KIAA0276Defective in cullin neddylation protein 1-like protein 4 |
|---|
| Gene, Accession # | DCUN1D4, Gene ID: 23142 |
|---|
| Catalog # | NBP1-81527 |
|---|
| Price | |
|---|
| Order / More Info | DCUN1D4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|