| 产品详情 |
| Edit |   |
| Antigenic Specificity | DCUN1D5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DCUN1D5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCUN1D5. This antibody reacts with human. The DCUN1D5 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DCUN1D5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWF |
| Other Names | DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae), DCN1-like protein 5, DCUN1 domain-containing protein 5, Defective in cullin neddylation protein 1-like protein 5, FLJ32431, FLJ37425, MGC2714 |
| Gene, Accession # | DCUN1D5, Gene ID: 84259, Accession: Q9BTE7, SwissProt: Q9BTE7 |
| Catalog # | NBP2-30432 |
| Price | |
| Order / More Info | DCUN1D5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|