| Edit |   |
| Antigenic Specificity | SPNS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, porcine, rabbit, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal Anti-SPNS2 Antibody |
| Immunogen | The immunogen for anti-SPNS2 antibody: synthetic peptide directed towards the N terminal of human SPNS2. Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY |
| Other Names | spinster homolog 2 (Drosophila) |
| Gene, Accession # | SPNS2, Accession: NM_001124758 |
| Catalog # | TA335127 |
| Price | |
| Order / More Info | SPNS2 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |