| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GLE1 |
|---|
| Clone | 1D8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GLE1 Antibody (1D8) from Novus Biologicals is a mouse monoclonal antibody to GLE1. This antibody reacts with human. The GLE1 Antibody (1D8) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | GLE1 (NP_001003722.1, 140 a.a. - 240 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQERLRKEE |
|---|
| Other Names | GLE1 (yeast homolog)-like, RNA export mediator, GLE1 RNA export mediator homolog (yeast), GLE1LGLE1 RNA export mediator-like (yeast), GLE1-like protein, GLE1-like, RNA export mediator, hGLE1GLE1 RNA export mediator (yeast), LCCS, LCCS1, lethal congenital contracture syndrome 1, nucleoporin GLE1 |
|---|
| Gene, Accession # | GLE1, Gene ID: 2733, Accession: NP_001003722, SwissProt: NP_001003722 |
|---|
| Catalog # | H00002733-M03 |
|---|
| Price | |
|---|
| Order / More Info | GLE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|