| Edit |   |
| Antigenic Specificity | UQCRFS1 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | dog |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-UQCRFS1 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-UQCRFS1 antibody: synthetic peptide directed towards the N terminal of human UQCRFS1. Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL |
| Other Names | RIP1, RIS1, RISP, UQCR5, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 |
| Gene, Accession # | UCRI, Accession: NM_006003 |
| Catalog # | TA344289 |
| Price | |
| Order / More Info | UQCRFS1 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |