| Edit |   |
|---|
| Antigenic Specificity | NUDT22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUDT22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDT22. This antibody reacts with human. The NUDT22 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the C terminal of NUDT22. Immunizing peptide sequence FYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELC. |
|---|
| Other Names | MGC13045, nucleoside diphosphate-linked moiety X motif 22, nudix (nucleoside diphosphate linked moiety X)-type motif 22, Nudix motif 22 |
|---|
| Gene, Accession # | NUDT22, Gene ID: 84304, Accession: Q9BRQ3, SwissProt: Q9BRQ3 |
|---|
| Catalog # | NBP1-74263 |
|---|
| Price | |
|---|
| Order / More Info | NUDT22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|